PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_11199.7
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family SBP
Protein Properties Length: 474aa    MW: 51133 Da    PI: 9.2184
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_11199.7genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP133.47.7e-42186262278
                   -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
           SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                   CqvegC++dls++keyhr+h+vCe hskap+v+v+gle+rfCqqCsrfh+lsefD++krsCrrrL++hn+rrrk+q+
  MLOC_11199.7 186 CQVEGCKVDLSSVKEYHRKHRVCELHSKAPKVVVAGLERRFCQQCSRFHALSEFDQKKRSCRRRLNDHNSRRRKPQP 262
                   **************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.7E-33178247IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.667183260IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.03E-39185265IPR004333Transcription factor, SBP-box
PfamPF031108.9E-32186259IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 474 aa     Download sequence    Send to blast
MGSFGMEWNQ RSSVLWDWEN FPPIGGDNPK NAMQAEPRFA AVAAAMGNEP LNSSGGSGTF  60
SSSSEMGYGS SKSSISASID SSSKAGSNME FRFAPVKNPD RNTSENTELG KVDNTRTGTS  120
PSSVVAVSSG EPVIGLKLGK RTYFEDVCGG QSVKSSPSGA ASVPNKSPAL SKKAKAEQQK  180
AHNSYCQVEG CKVDLSSVKE YHRKHRVCEL HSKAPKVVVA GLERRFCQQC SRFHALSEFD  240
QKKRSCRRRL NDHNSRRRKP QPEAISFSSS RMSTMFYDAR QQPNFLFGQA PYVQMRSCGS  300
SSWDEPGGFK VTHTKAPWLK PTTAAGVDGM HLSSQQMSDN VMPHGAHHGF DGFMAFKGTS  360
TKFPNQGVQA SAVAPNSSGA PDLQHALSLL SSNPVGAANL QPTSQMHSGV AAIAGTPNPA  420
MHVLGSSAGL WLDGGPPLDD HPRFQVFERL GDHDSELQLP KPSYDHASHF DRMH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-271862591184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1241258KKRSCRRRLNDHNSRRRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3550450.0AK355045.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1015D14.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014756343.10.0PREDICTED: squamosa promoter-binding-like protein 3
RefseqXP_014756342.10.0PREDICTED: squamosa promoter-binding-like protein 3
RefseqXP_010233795.10.0PREDICTED: squamosa promoter-binding-like protein 3
RefseqXP_003574437.10.0PREDICTED: squamosa promoter-binding-like protein 3
RefseqXP_010233792.10.0PREDICTED: squamosa promoter-binding-like protein 3
SwissprotA2X0Q60.0SPL3_ORYSI; Squamosa promoter-binding-like protein 3
SwissprotA3A2Z80.0SPL3_ORYSJ; Squamosa promoter-binding-like protein 3
TrEMBLF2CTU30.0F2CTU3_HORVD; Predicted protein
STRINGMLOC_11199.10.0(Hordeum vulgare)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43270.32e-43squamosa promoter binding protein-like 2